PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.8G028100.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 490aa    MW: 53070.6 Da    PI: 7.0574
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.8G028100.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS284.92.3e-87194633374
                GRAS   3 elLlecAeavssgdlelaqalLarlselaspdg.dpmqRlaayfteALaarlar.svselykalppsetseknsseelaalklfsevsPil 91 
                         ++L ecA  v++g++e+a + L+r   la+ +g  p+ Rla  ++  La+rl r +v+ +++al   +++  +   + aa++ f+e+sP++
  Sevir.8G028100.1.p  19 RALCECAADVEAGSMEKAARWLSRATGLAAATGgGPLPRLAVPVADCLARRLIRpMVPAVADALIDPSDH-LDRRCVRAARRSFFELSPFP 108
                         689*************************7777769*******************8999999988444443.345555678999******** PP

                GRAS  92 kfshltaNqaIleavegeervHiiDfd..isqGlQWpaLlqaLasRpegppslRiTgvgspesgskeeleetgerLakfAeelgvpfefnv 180
                         k +  +aN+ Ilea+e+e+ vH+iDf   + q+ QW+ Ll+ + s peg+p+lR+T v++    ++e l ++ e L + A++l+vp++ + 
  Sevir.8G028100.1.p 109 KAAVAVANRVILEAMENEKNVHVIDFAgpAAQPCQWIQLLRVFRSLPEGAPHLRLTIVHD----DEEFLAKVSESLVDEADRLDVPLQVHC 195
                         **************************75589*****************************....9************************** PP

                GRAS 181 lvakrledleleeL....rvkpgEalaVnlvlqlhrll..................................................... 214
                          va ++e+l++++L     +k+gEa a+ + l+lhrll                                                     
  Sevir.8G028100.1.p 196 -VAGQIETLDFSDLhgvlGLKSGEARAIVCTLRLHRLLaaadeaassfsaghrsnqtasvarlqqmasnscplsigggaaceeeeedpyyr 285
                         .7999******99966667889********************************************************************* PP

                GRAS 215 ..............desvsleserdevLklvks.lsPkvvvvveqeadhnsesFlerflealeyysalfdsleaklpres...eerikvEr 287
                                         + +++ +   +L++ +  +sPk+vv++eqea+hn+ sF +rf+eal++y+a++dsl+a +++      er+ vEr
  Sevir.8G028100.1.p 286 spatplgfvsppltTPPFQMPPALAGFLSAARAtVSPKIVVLAEQEASHNGVSFRKRFAEALHHYAAVYDSLDAAAAAYRrppAERAEVER 376
                         ************99666777777778*****9538*************************************877665555779******* PP

                GRAS 288 ellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWkdrpLvsvSaWr 374
                         ++l++ei++++   ga+rrerh +l++W  r+e aGF+ vpls+ a  q + +lr++++ g +  e+ g+l+l+Wk+ pL+svSaWr
  Sevir.8G028100.1.p 377 AVLSEEIRDLLLRDGARRRERHDRLHQWALRMEVAGFRGVPLSYIALRQGDDVLRRCGVGGCESREHGGCLLLCWKSWPLYSVSAWR 463
                         **************************************************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098541.8891443IPR005202Transcription factor GRAS
PfamPF035147.9E-8519463IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MRPPPAENGP DRRLAHLGRA LCECAADVEA GSMEKAARWL SRATGLAAAT GGGPLPRLAV  60
PVADCLARRL IRPMVPAVAD ALIDPSDHLD RRCVRAARRS FFELSPFPKA AVAVANRVIL  120
EAMENEKNVH VIDFAGPAAQ PCQWIQLLRV FRSLPEGAPH LRLTIVHDDE EFLAKVSESL  180
VDEADRLDVP LQVHCVAGQI ETLDFSDLHG VLGLKSGEAR AIVCTLRLHR LLAAADEAAS  240
SFSAGHRSNQ TASVARLQQM ASNSCPLSIG GGAACEEEEE DPYYRSPATP LGFVSPPLTT  300
PPFQMPPALA GFLSAARATV SPKIVVLAEQ EASHNGVSFR KRFAEALHHY AAVYDSLDAA  360
AAAYRRPPAE RAEVERAVLS EEIRDLLLRD GARRRERHDR LHQWALRMEV AGFRGVPLSY  420
IALRQGDDVL RRCGVGGCES REHGGCLLLC WKSWPLYSVS AWRPDRGAAY GIGCDYLSLS  480
APPGPVHSF*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A5e-15319463231375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004980153.20.0PREDICTED: scarecrow-like protein 3
TrEMBLK3ZNT20.0K3ZNT2_SETIT; Uncharacterized protein
STRINGSi028262m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP60438176
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G50420.12e-53scarecrow-like 3